General Information

  • ID:  hor000162
  • Uniprot ID:  P19806
  • Protein name:  CHH precursor-related peptide
  • Gene name:  NA
  • Organism:  Homarus americanus (American lobster)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Present also in the ventral nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSVEGASRMEKLLS
  • Length:  14
  • Propeptide:  MMACRTLCLVVVMVASLGTSGVGGRSVEGASRMEKLLSSSNSPSSTPLGFLSQDHSVNKRQVFDQACKGVYDRNLFKKLDRVCEDCYNLYRKPFVATTCRENCYSNWVFRQCLDDLLLSDVIDEYVSNVQMVGK
  • Signal peptide:  MMACRTLCLVVVMVASLGTSGVGG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CHH is the most abundant hormone in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone.; MIH may inhibit Y-organs where molting hormone (ecdysteroid) is secreted and a molting cycle is initiated when MIH secretion diminishes or stops.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P19806-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000162_AF2.pdbhor000162_ESM.pdb

Physical Information

Mass: 179485 Formula: C64H115N21O22S
Absent amino acids: CDFHINPQTWY Common amino acids: S
pI: 9.69 Basic residues: 3
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -51.43 Boman Index: -4023
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 83.57
Instability Index: 4230 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20025296
  • Title:  Mass Spectral Analysis of Neuropeptide Expression and Distribution in the Nervous System of the Lobster Homarus Americanus